Articles of текстовая обработка

Как удалить многострочную запись из текстового файла?

Например, test.txt содержит: Hi Hello Hi world Код ниже удаляет слово из test.txt и создает файл temp test_removed.txt, который содержит: #!/bin/bash echo -n Enter Input: read input sed -e "/^${input}/d" test.txt > test_removed.txt Код ниже выполняет поиск вашего слова и распечатает его. Например, если вы выполните поиск «Привет», он распечатает «Hi Hi World» точно так […]

Добавьте ярлык быстрого доступа к ярлыкам gnome

У меня есть программа, которая получает текст из буфера обмена, выполняет некоторые операции над ним и возвращает его в буфер обмена. Затем программа выключается. Могу ли я сделать ярлык – например, сочетание клавиш gnome, пункт контекстного меню и т. Д. – для этого, который вырезает выделенный текст, запускает мою программу и вставляет текст? Или у […]

Печать нескольких строк, начинающихся с «D» после нескольких greps

У меня есть два текстовых файла. Текстовый файл-1 содержит строки (по одной строке в строке); C 010 C 020 C 024 . . . Текстовый файл-2 содержит данные в следующем формате; C 005 Carbon D Carbon 1 D Carbon 2 D Carbon 3 D Carbon 4 C 010 Hydrogen D Hydrogen 1 D Hydrogen 2 […]

копировать несколько строк из одного файла в другой

Я хотел бы использовать grep, чтобы скопировать из одного файла в другой все строки, которые находятся между строками /protein_id= до конца указанной последовательности белка. Например, из этого ввода: CDS 448..1269 /gene="nptII" /note="neomycin phosphotransferase II" /codon_start=1 /product="kanamycin resistance protein" /protein_id="AAQ05967.1" /db_xref="GI:33320494" /translation="MAITLSATSLPISARIRAGSPAAWVERLFGYDWAQQTIGCSDAA VFRLSAQGRPVLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLL LGEVPGQDLLSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAG LVDQDDLDEEHQGLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDC GRLGVADRYQDIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" regulatory 1443..2148 Я хотел бы получить этот результат: /protein_id="AAQ05967.1" /db_xref="GI:33320494" […]

Как использовать sed с переменными пути к файлу И обратные вызовы regex И арифметические выражения

Я получаю адский синтаксис с помощью sed с переменными, содержащими путь к файлу, обратный вызов регулярного выражения и арифметическое выражение. Я не знаю, как правильно избегать вещей. У меня есть путь к файлу в текстовом файле с рядом рядом с ним. Я хочу найти эту строку и увеличить число. FILE="/home/username/scripts/test.txt" LINE="/home/username/Pictures/properties/wallpaper/span/tree.jpg" sed -i -e "s,'$LINE' […]

заменить символы на разрыв строки (\ n) и добавить три первых столбца из начала строки

У меня есть файл журнала с текстом: Jan 10 09:56:17 1484207777.225918 GET "8.8.8.8" "curl/7.27.0" #0121484207777.226639 GET "8.8.8.9" "curl/7.21.0" #0121484207777.226639 GET "8.8.5.9" "curl/7.22.0" Jan 10 19:59:17 1484207777.225456 GET "8.8.6.8" "curl/7.24.0" #0121484207777.226639 GET "8.8.5.9" "curl/7.21.0" #0121484207777.226425 GET "8.8.5.9" "curl/7.22.0" Мне нужно заменить символы «#» на разрыв строки (\ n) и добавить дату / время из этой строки. […]

Генерировать вывод дерева из конкретного / общего XML-файла в Bash

Я пытаюсь сгенерировать дерево из файла XML в Bash. Это часть XML-файла: <ke3600-menu-file language="en" display="English" index="1"> <version major="0" minor="1" patch="0"/> <locale name="en_EN" timezone="CET-1CEST,M3.5.0,M10.5.0/3"/> <menu name="main_menu" display="Main Menu"> <menu name="broadband" display="Broadband" help="100_help_broadband"> <onenter proc="activateGfast"/> <menu name="load_save_profiles" display="Load and Save Profiles" help="601_help_profiles"> <application name="load_profiles" display="Load Profile"/> <application name="save_profiles" display="Save Profile"/> <application name="remove_profiles" display="Delete Profile"/> </menu> <parameter type="list" […]

Как сравнить две строки в файле?

Скажем, у меня есть файл foo.csv : timestamp,id,ip_src,ip_dst,protocol,msg 08/20-12:01:22.172612 ,1000001,10.0.0.2,10.0.0.1,ICMP,"ICMP test detected" 08/20-12:03:22.172809 ,1000001,10.0.0.6,10.0.0.3,ICMP,"ICMP test detected" 08/20-12:06:22.172940 ,1000001,10.0.0.1,10.0.0.2,ICMP,"ICMP test detected" 08/20-12:06:22.172838 ,1000001,10.0.0.9,10.0.0.2,ICMP,"ICMP test detected" 08/20-12:10:23.173945 ,1000001,10.0.0.8,10.0.0.1,ICMP,"ICMP test detected" 08/20-12:19:23.173982 ,1000001,10.0.0.1,10.0.0.8,ICMP,"ICMP test detected" Я хочу, чтобы сравнить ip_src с последней строкой и проверить строку над ней, пока не найдет строку с таким же адресом ip. Я […]

Как мне присоединиться к двум файлам CSV, но только в том случае, где совпадает второй файл?

У меня есть 2 файла CSV: Объект Файл: IP,MASK,DESCRIPTION 10.10.3.94,255.255.255.255,Rob 10.10.3.95,255.255.255.255,Mark 10.10.3.96,255.255.255.255,John Файл служб: DESCRIPTION,OrgIP,Service Rob,1.1.1.1,Purple John,2.2.2.2,Green Mark,3.3.3.3,Yellow Файл объектов имеет 3000 строк, у служебного файла – около 500. Я хочу создать новый файл, который имеет все строки из служб с добавленными полями полей, где найдено совпадение в описании. Таким образом, желаемый результат будет выглядеть […]

Как искать и вырезать строки из файла?

Я пытаюсь написать программу с параметрами и аргументами вроде этого: ./program.sh -f <filename> -string <string> Предполагается, что программа выводит строку <filename> которая начинается с <string> следующим образом: grep ^<string> <filename> Плюс он должен вернуть некоторую информацию, связанную со строкой, например имя и возраст в следующем примере входного файла: string name age sex Akdk john 22 […]