Articles of текстовая обработка в

Удаление определенных символов и печать в отдельных строках

Мне нужна ваша срочная помощь и руководство, у меня есть файл, в котором есть 1000 последовательностей, из которых я хочу расщепить K и R и вставить оставшиеся последовательности по строкам. Файл A: MSTNPKPQRK TKRNTNRRPE DVKFPGGQI Желаемый результат: MSTNP PQ T NTN PE DV FPGGQI Получив этот вывод, я хочу искать отдельные последовательности в файле B […]

Как удалить все строки до и после определенных строк в файле?

Я играл с Powergrep и регулярными выражениями, но я не знаю, как это сделать: У меня есть текстовый файл (исходный код веб-страницы), и я хочу удалить весь текст (много строк) до конкретной строки в коде: STRING1 (тег html), а также весь текст после другой конкретной строки: STRING2 . Эти строки появляются только один раз в […]

Найти и заменить номера в нескольких текстовых файлах с измененным исходным номером?

Мне нужно найти все строки «5dp» и заменить их на «(5 * 0.83) dp», округленные до целых чисел. Число 5 может быть любым числом, и выражение в скобках фактически выполняется. Например: 31dp должен стать 25dp . Мне нужно искать все файлы в каталоге и подкаталоги рекурсивно. Любая помощь?

Захват номера из строкового вывода в командной строке

Как я могу получить только номер из вывода командной строки. Например, у меня есть программа, которая при запуске выводит строку типа submitted batch with job number 12345 Я хотел бы получить только номер 12345 и передать его в другую программу.

Удаление нескольких шаблонов из строк fasta

Мне нужно изменить этот шаблон >UniRef90_Q57KY8 Total protein n=182 Tax=GammaproteobacteriaTaxID=1236 RepID=Q57KY8_SALCH MKKQLIRTLTASILLMSTSVLAQEAPSRTECIAPAKPGGGFDLTYKLIQVSLLETGAIEKPMRVTYMPGGVGAVAYNAIV AQRPGEPGTVVAFSGGSLLNLSQGKFGRYGVDDVRWLASVGTDYGMIAVRADSPWKTLKDLMTAMEKDPNSVVIGAGASI GSQDWMKSALLAQKANVDPHKMRYVAFEGGGEPVTALMGNHVQVVSGDLSEMVPYLGGDKIRVLAVFSENRLPGQLANVP TAKEQGYDLVWPIIRGFYVGPKVSDADYQWWVDTFKKLQQTDEFKKQRDLRGLFEFDMTGQQLDDYVKKQVTDYREQAKAFGLAK >UniRef90_G8LKQ2 UPF5341 protein yflP n=80 Tax=Bacteria TaxID=2 RepID=G8LKQ2_ENTCL MKKQLLSTLAASVLMISASVVQAQDAPSRTECIAPAKPGGGFDLTCKLIQVSMLETGAIAKPMRVTYMPGGVGAVAYNAI VAQRPAEAGTVVAFSGGSLLNLSQGKFGRYGVDDVRWLATVGTDYGMIAVRADSPWKSLKDLLTAMEKDPNSVVIGAGAS IGSQDWMKAALLAQQAKVDPHKMRYVAFEGGGEPVTALMGNHVQAVSGDLSEMVPYLNGDKIRVLAVFSENRLPGQLANV PTAKEQGYDLVWPIIRGFFVGPKVTDAEYQWWVETFNKLQQTEAFKKQRDLRGLFEFNLSGKPLDEYVKKQVNDYREQAKAFGLAK >UniRef90_E3GB58 Uncharacterized protein n=1 Tax=Enterobacter lignolyticus (strain SCF1) TaxID=701347 RepID=E3GB58_ENTLS MKKTLLQTVIATALLMSTAAFAVEAPGRTECIAPAKPGGGFDLTCKLIQVSLQETGAIEKPMRVTYMPGGVGAVAYNAIV AQRPAEAGTVVAFSGGSLLNLSQGKFGRYGVDDVRWLASVGTDYGMIAVRADSPWKSLKDLLTAMEKDPNSVVIGAGASI GSQDWMKAAKLAQQAKVDPHKMRYVAFEGGGEPVTALMGNHVQAVSGDLSEMVPYLQGDKIRVLAVFAENRLPGQLANVP TAKEQGYDLVWPIIRGFYLGPKVSDDEYNWWVETFQKLQQTDEFKKQRELRGLFEFNMNGKALDEYVKKQVTDYREQAKSFGLAK Что-то вроде >Q57KY8_Gammaproteobacteria MKKQLIRTLTASILLMSTSVLAQEAPSRTECIAPAKPGGGFDLTYKLIQVSLLETGAIEKPMRVTYMPGGVGAVAYNAIV AQRPGEPGTVVAFSGGSLLNLSQGKFGRYGVDDVRWLASVGTDYGMIAVRADSPWKTLKDLMTAMEKDPNSVVIGAGASI GSQDWMKSALLAQKANVDPHKMRYVAFEGGGEPVTALMGNHVQVVSGDLSEMVPYLGGDKIRVLAVFSENRLPGQLANVP TAKEQGYDLVWPIIRGFYVGPKVSDADYQWWVDTFKKLQQTDEFKKQRDLRGLFEFDMTGQQLDDYVKKQVTDYREQAKAFGLAK >G8LKQ2_Bacteria MKKQLLSTLAASVLMISASVVQAQDAPSRTECIAPAKPGGGFDLTCKLIQVSMLETGAIAKPMRVTYMPGGVGAVAYNAI VAQRPAEAGTVVAFSGGSLLNLSQGKFGRYGVDDVRWLATVGTDYGMIAVRADSPWKSLKDLLTAMEKDPNSVVIGAGAS IGSQDWMKAALLAQQAKVDPHKMRYVAFEGGGEPVTALMGNHVQAVSGDLSEMVPYLNGDKIRVLAVFSENRLPGQLANV PTAKEQGYDLVWPIIRGFFVGPKVTDAEYQWWVETFNKLQQTEAFKKQRDLRGLFEFNLSGKPLDEYVKKQVNDYREQAKAFGLAK >E3GB58_Enterobacter lignolyticus […]

Как мне группировать / etc / passwd и / etc / shadow содержимое файла в новый файл по имени пользователя?

Предположим, что у меня есть контент в файле / etc / shadow, например: root:!!:16087:::::: ftp:!!:14796:::::: и в файле / etc / passwd: ftp:x:40:49:FTP account:/srv/ftp:/sbin/nologin root:x:0:0:root:/root:/bin/bash Я хочу сгруппировать их так: ftp:!!:14796::::::x:40:49:FTP account:/srv/ftp:/sbin/nologin root:!!:16087:::::::x:0:0:root:/root:/bin/bash Что я сделал выше: Сначала я нашел имя пользователя команды из обоих файлов, а затем объединил их в одну строку. Кроме того, […]

Как я могу удалить из текстового файла эти специальные символы

У меня есть файл со специальными символами, которые были созданы во время копирования с терминала. Теперь я хотел бы удалить их. Я пробовал grep и sed, но не работал, может быть, я делаю это неправильно. Специальный символ – это ESC внутри черного ящика, не могу его скопировать, но если я это сделаю, он превратится в […]

Объединение 2 файлов на основе одного столбца

Я хотел бы объединить два файла. Я рассмотрел предыдущие вопросы и ответы, но ни один из них не соответствовал моему желаемому результату. У меня есть два разделенных запятыми файлов разной длины, file1.csv и file2.csv . Мне нужно объединить эти файлы на основе их первого поля. Если первое поле file1.csv присутствует в file2.csv , то соответствующая […]

Использование команды awk и sed внутри perl

У меня есть простая команда awk и sed, которую я хочу записать в perl-скрипт или, альтернативно, использовать perl-эквивалент? Любые указатели будут оценены sed -e '1d;4d' -e 's/#/Time/' -e 's/TGID/PID/' -e 's/%guest/%CPU/' -e 's/RSS/%MEM/' awk '{ print $1,$3,$7,$13,$NF }'

Удалите любые завершающие пустые строки или строки с пробелами из конца файла

Я хочу удалить все пустые строки и строки с пробелами (если они существуют (ТОЛЬКО от нижней части файла)), а затем удалить еще одну строку (также ТОЛЬКО от нижней части файла). У меня есть этот код: while [[ "$last_line" =~ $ ]] || [[ "$last_line" =~ ^[[:space:]]+$ ]] do sed -i -e '${/$/d}' "./file.txt" done sed […]