Articles of grep

синтаксическая ошибка с регулярным выражением в unix

Я попытался найти регулярное выражение, которое соответствует любому числу между 1 и 999. Когда используется крючки, я получаю синтаксическую ошибку (bash: syntax error near unexpected token `(‘) и когда я не использую крючки, ничего не происходит. мое регулярное выражение: egrep ^([1-9][0-9]?|)$ Numbers Обновить: но как я могу заставить его проверить файл, который я хочу проверить, […]

Разделить переменную по строкам

Я инициализирую переменную следующим образом: dmesgDevs=$(dmesg | grep idVendor) и хотите распечатать его по строкам, а затем проверить, является ли theres слово в конкретной строке.

Как я могу извлечь страницы, содержащие заданную строку из файла PDF?

У меня есть файл PDF, содержащий 100 страниц. Я хотел бы извлечь эти страницы, содержащие определенную строку. Как я могу это достичь? Может быть, используя ghostscript в командной строке? Для чего это стоит: я использую Edubuntu 12.04 LTS.

Отсутствует php.ini после apt-get install php5

Я только что установил php5 как root через apt-get install php5 , и по какой-то причине я не могу найти файл php.ini . Запуск locate php.ini или ls /etc/ | grep php.ini ls /etc/ | grep php.ini не дает никаких результатов. Здесь что-то не хватает?

Скопируйте определенный текст из одного файла в другой с помощью GREP или SED

Я должен скопировать номер 795 и использовать его в другом файле. Это 795 может быть любым числом и может меняться от файла к файлу. Все, до тех пор, пока предприятия не останутся прежними, даже конечные фигурные скобки. Итак, это OBJECT IDENTIFIER ::= { enterprises 795 } это произойдет в другом файле VAR="759" Я хочу сделать […]

Программирование оболочки с помощью sed для удаления строки из txt-файла

Я хочу удалить строку из .txt-файла, используя функции grep и sed, но полученный результат не изменяет ни одну из моих данных в текстовом файле. Любые предложения о том, как получить желаемый результат? Спасибо. И название, и год объявляются как массив; Формат информации в файле .txt (название): (год): (просмотров): (рейтинг) function remove_movie { echo "Please Key […]

Команда для записи всех .js-файлов в один файл?

Я пытаюсь поместить все .js файлы в каталог и подкаталоги в один файл в лексическом порядке. Я пытался: grep -r –include=*.js * > dir/.filename Что я сделал не так?

копировать несколько строк из одного файла в другой

Я хотел бы использовать grep, чтобы скопировать из одного файла в другой все строки, которые находятся между строками /protein_id= до конца указанной последовательности белка. Например, из этого ввода: CDS 448..1269 /gene="nptII" /note="neomycin phosphotransferase II" /codon_start=1 /product="kanamycin resistance protein" /protein_id="AAQ05967.1" /db_xref="GI:33320494" /translation="MAITLSATSLPISARIRAGSPAAWVERLFGYDWAQQTIGCSDAA VFRLSAQGRPVLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLL LGEVPGQDLLSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAG LVDQDDLDEEHQGLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDC GRLGVADRYQDIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" regulatory 1443..2148 Я хотел бы получить этот результат: /protein_id="AAQ05967.1" /db_xref="GI:33320494" […]

Проверьте, есть ли у меня определенный ppa

Как проверить, есть ли у меня определенный ppa в моем списке? Как выполнить поиск в моем списке ppa?

линии фильтра, содержащие ключевое слово и идентификатор, если идентификатор снова появляется на другой строке

Этот вопрос представляет собой вариант: Как сделать grep для нескольких шаблонов на нескольких строках? Это образец текста, где строки, содержащие «reqId: regexpat» или «reqCompleted: regexpat», должны быть сопоставлены парами, где «regexpat» уникален, на самом деле это может быть UUID. 2016-09-27 GET /some/uri – reqId: 000-pat1-bgr, more text 2016-09-27 GET /some/uri – reqId: 0.215487, your favourite […]